SARS-CoV-2 Nsp3

This reagent and more can be found at our sister site MRC PPU Reagents & Services
Request Now
Plasmid
pTYB2 Nsp3 A1-N1329 Linker D1584-G1945 C856A Intein CBD
Parent Plasmid
pTYB2
Expressed
Nsp3 A1-N1329 Linker D1584-G1945 C856A Intein CBD
DU Number
DU70095
Genbank
MN908947.3
Species
SARS-CoV-2
Sequence of Insert
CATATGGCCCCTACCAAGGTGACCTTCGGAGACGACACCGTGATCGAGGTGCAGGGTTACAAGAGCGTGAACATCACCTTCGAGCTGGACGAACGCATCGACAAGGTGCTGAACGAAAAGTGCTCCGCTTACACCGTGGAGCTGGGCACCGAGGTGAACGAATTCGCCTGCGTGGTGGCCGACGCTGTGATCAAGACCCTGCAGCCAGTGTCCGAACTGCTGACCCCTCTGGGTATCGACCTGGACGAGTGGTCTATGGCTACCTACTACCTGTTCGACGAGAGCGGCGAATTCAAGCTGGCCTCTCACATGTACTGCAGCTTCTACCCTCCCGACGAAGACGAGGAAGAGGGTGACTGCGAAGAGGAAGAGTTCGAGCCTTCCACTCAGTACGAGTACGGCACCGAAGACGACTACCAGGGCAAGCCTCTGGAATTCGGAGCCACCTCTGCCGCTCTGCAGCCTGAAGAGGAACAGGAGGAAGACTGGCTGGACGACGACTCCCAGCAGACCGTGGGTCAGCAGGACGGCTCTGAAGACAACCAGACCACCACCATCCAGACCATCGTGGAGGTGCAGCCTCAGCTGGAGATGGAACTGACCCCAGTGGTGCAGACCATCGAGGTGAACAGCTTCTCCGGCTACCTGAAGCTGACCGACAACGTGTACATCAAGAACGCTGACATCGTGGAGGAAGCCAAGAAGGTGAAACCAACCGTGGTGGTGAACGCCGCTAACGTGTACCTGAAGCACGGCGGAGGTGTGGCTGGAGCTCTGAACAAGGCTACCAACAACGCCATGCAGGTGGAATCCGACGACTACATCGCTACCAACGGTCCTCTGAAGGTGGGCGGATCCTGCGTGCTGTCTGGCCACAACCTGGCCAAGCACTGCCTGCACGTGGTGGGACCAAACGTGAACAAGGGAGAGGACATCCAGCTGCTGAAGAGCGCCTACGAAAACTTCAACCAGCACGAGGTGCTGCTGGCTCCACTGCTGTCTGCCGGAATCTTCGGTGCTGATCCCATCCACAGCCTGCGCGTGTGCGTGGACACCGTGAGGACCAACGTGTACCTGGCCGTGTTCGACAAGAACCTGTACGACAAGCTGGTGAGCTCCTTCCTGGAGATGAAGTCCGAAAAGCAGGTGGAGCAGAAGATCGCCGAGATCCCCAAGGAGGAAGTGAAGCCTTTCATCACCGAATCTAAGCCCAGCGTGGAGCAGAGAAAGCAGGACGACAAGAAGATCAAGGCCTGCGTGGAGGAAGTGACCACCACCCTGGAGGAAACCAAGTTCCTGACCGAGAACCTGCTGCTGTACATCGACATCAACGGCAACCTGCACCCTGACTCCGCTACCCTGGTGTCTGACATCGACATCACCTTCCTGAAGAAGGACGCCCCCTACATCGTGGGCGACGTGGTGCAGGAAGGAGTGCTGACCGCTGTGGTCATCCCTACCAAGAAGGCCGGTGGCACCACCGAGATGCTGGCCAAGGCTCTGCGTAAGGTGCCAACCGACAACTACATCACCACCTACCCCGGTCAGGGCCTGAACGGTTACACCGTGGAGGAAGCTAAGACCGTGCTGAAGAAGTGCAAGTCTGCCTTCTACATCCTGCCCTCCATCATCTCTAACGAGAAGCAGGAAATCCTGGGCACCGTGAGCTGGAACCTGCGCGAAATGCTGGCCCACGCTGAGGAAACCAGGAAGCTGATGCCCGTGTGCGTGGAGACCAAGGCCATCGTGAGCACCATCCAGAGAAAGTACAAGGGCATCAAGATCCAGGAGGGTGTGGTGGACTACGGCGCTCGTTTCTACTTCTACACCTCCAAGACCACCGTGGCCTCTCTGATCAACACCCTGAACGACCTGAACGAGACCCTGGTGACCATGCCACTGGGATACGTGACCCACGGTCTGAACCTGGAGGAAGCCGCTAGATACATGCGTTCCCTGAAGGTGCCTGCTACCGTGAGCGTGAGCAGCCCTGACGCTGTGACCGCCTACAACGGATACCTGACCTCCTCTAGCAAGACCCCTGAGGAACACTTCATCGAAACCATCAGCCTGGCCGGTTCCTACAAGGACTGGTCTTACAGCGGACAGTCCACCCAGCTGGGCATCGAGTTCCTGAAGCGCGGAGACAAGAGCGTGTACTACACCTCCAACCCAACCACCTTCCACCTGGACGGTGAAGTGATCACCTTCGACAACCTGAAGACCCTGCTGTCTCTGCGCGAGGTGAGGACCATCAAGGTGTTCACCACCGTGGACAACATCAACCTGCACACCCAGGTGGTGGACATGAGCATGACCTACGGACAGCAGTTCGGTCCTACCTACCTGGACGGAGCTGACGTGACCAAGATCAAGCCACACAACTCCCACGAGGGCAAGACCTTCTACGTGCTGCCTAACGATGACACCCTGAGAGTGGAGGCTTTCGAATACTACCACACCACCGACCCATCCTTCCTGGGCAGGTACATGTCTGCCCTGAACCACACCAAGAAGTGGAAGTACCCCCAGGTGAACGGACTGACCAGCATCAAGTGGGCCGACAACAACGCCTACCTGGCCACCGCTCTGCTGACCCTGCAGCAGATCGAACTGAAGTTCAACCCACCCGCTCTGCAGGACGCTTACTACAGAGCCCGTGCTGGCGAGGCCGCTAACTTCTGCGCTCTGATCCTGGCCTACTGCAACAAGACCGTGGGCGAACTGGGAGACGTGAGAGAGACCATGAGCTACCTGTTCCAGCACGCCAACCTGGACTCCTGCAAGCGTGTGCTGAACGTGGTGTGCAAGACCTGCGGCCAGCAGCAGACCACCCTGAAGGGAGTGGAAGCTGTGATGTACATGGGTACCCTGTCCTACGAGCAGTTCAAGAAGGGCGTGCAGATCCCTTGCACCTGCGGAAAGCAGGCCACCAAGTACCTGGTGCAGCAGGAAAGCCCATTCGTGATGATGTCCGCTCCTCCAGCCCAGTACGAACTGAAGCACGGCACCTTCACCTGCGCTTCCGAGTACACCGGCAACTACCAGTGCGGACACTACAAGCACATCACCTCTAAGGAGACCCTGTACTGCATCGACGGAGCCCTGCTGACCAAGTCCTCTGAATACAAGGGTCCCATCACCGACGTGTTCTACAAGGAGAACAGCTACACCACCACCATCAAGCCCGTGACCTACAAGCTGGACGGCGTGGTGTGCACCGAAATCGACCCTAAGCTGGACAACTACTACAAGAAGGACAACTCTTACTTCACCGAGCAGCCTATCGACCTGGTGCCAAACCAGCCCTACCCTAACGCCAGCTTCGACAACTTCAAGTTCGTGTGCGACAACATCAAGTTCGCTGACGACCTGAACCAGCTGACCGGATACAAGAAGCCTGCCTCTAGAGAGCTGAAGGTGACCTTCTTCCCAGACCTGAACGGCGACGTGGTGGCTATCGACTACAAGCACTACACCCCAAGCTTCAAGAAGGGAGCCAAGCTGCTGCACAAGCCCATCGTGTGGCACGTGAACAACGCTACCAACAAGGCCACCTACAAGCCTAACACCTGGTGCATCCGTTGCCTGTGGTCTACCAAGCCAGTGGAAACCTCCAACTCTTTCGACGTGCTGAAGAGCGAGGACGCTCAGGGCATGGACAACCTGGCCTGCGAAGACCTGAAGCCCGTGAGCGAGGAAGTGGTGGAGAACCCAACCATCCAGAAGGACGTGCTGGAATGCAACGTGAAGACCACCGAGGTGGTGGGAGACATCATCCTGAAGCCAGCTAACAACAGCCTGAAGATCACCGAGGAAGTGGGTCACACCGACCTGATGGCCGCTTACGTGGACAACAGCTCCCTGACCATCAAGAAGCCCAACGAGCTGAGCAGGGTGCTGGGTCTGAAGACCCTGGCTACTCACGGTCTGGCTGCTGTGAACTCTGTGCCATGGGACACCATCGCTAACTACGCCAAGCCTTTCCTGAACggtagtGGAGGgTCAggaTCAGGAggtTCCagtGGTgggtcaggaGACGGTTGCAACTCCTCTACCTGCATGATGTGCTACAAGCGCAACAGGGCTACCAGGGTGGAGTGCACCACCATCGTGAACGGCGTGCGCAGGTCCTTCTACGTGTACGCCAACGGCGGCAAGGGATTCTGCAAGCTGCACAACTGGAACTGCGTGAACTGCGACACCTTCTGCGCTGGCTCCACCTTCATCTCTGACGAGGTGGCCAGAGACCTGAGCCTGCAGTTCAAGCGTCCAATCAACCCCACCGACCAGAGCTCCTACATCGTGGACTCTGTGACCGTGAAGAACGGTAGCATCCACCTGTACTTCGACAAGGCTGGCCAGAAGACCTACGAGCGCCACTCTCTGAGCCACTTCGTGAACCTGGACAACCTGAGGGCCAACAACACCAAGGGCAGCCTGCCTATCAACGTGATCGTGTTCGACGGAAAGTCCAAGTGCGAGGAATCTAGCGCCAAGTCCGCCAGCGTGTACTACAGCCAGCTGATGTGCCAGCCAATCCTGCTGCTGGACCAGGCTCTGGTGTCTGACGTGGGAGACAGCGCCGAAGTGGCCGTGAAGATGTTCGACGCCTACGTGAACACCTTCTCCTCTACCTTCAACGTGCCTATGGAGAAGCTGAAGACCCTGGTGGCTACTGCTGAGGCTGAACTGGCTAAGAACGTGTCCCTGGACAACGTGCTGAGCACCTTCATCTCCGCCGCTAGGCAGGGTTTCGTGGACTCTGACGTGGAAACCAAAGACGTGGTGGAGTGCCTGAAGCTGTCTCACCAGAGCGACATCGAAGTGACCGGCGACTCCTGCAACAACTACATGCTGACCTACAACAAGGTGGAGAACATGACCCCAAGAGACCTGGGAGCTTGCATCGACTGCTCCGCCCGTCACATCAACGCTCAGGTGGCCAAGTCTCACAACATCGCCCTGATCTGGAACGTGAAGGACTTCATGAGCCTGTCCGAGCAGCTGCGCAAGCAGATCAGGAGCGCCGCTAAGAAGAACAACCTGCCCTTCAAGCTGACCTGCGCTACCACCAGACAGGTGGTGAACGTGGTGACCACCAAGATCGCCCTGAAGGGCGGACTCGAG
Amino Acid Sequence
HMAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKL
ASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMEL
TPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLH
VVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFIT
ESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNLHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKA
LRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVV
DYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSY
SGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGK
TFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNAYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILA
YCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYEL
KHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIKPVTYKLDGVVCTEIDPKLDNYYKKDNSYFTEQPIDLVP
NQPYPNASFDNFKFVCDNIKFADDLNQLTGYKKPASRELKVTFFPDLNGDVVAIDYKHYTPSFKKGAKLLHKPIVWHVNNATNKATYKPNTWCIRCLWST
KPVETSNSFDVLKSEDAQGMDNLACEDLKPVSEEVVENPTIQKDVLECNVKTTEVVGDIILKPANNSLKITEEVGHTDLMAAYVDNSSLTIKKPNELSRV
LGLKTLATHGLAAVNSVPWDTIANYAKPFLNGSGGSGSGGSSGGSGDGCNSSTCMMCYKRNRATRVECTTIVNGVRRSFYVYANGGKGFCKLHNWNCVNC
DTFCAGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVTVKNGSIHLYFDKAGQKTYERHSLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCEESSAK
SASVYYSQLMCQPILLLDQALVSDVGDSAEVAVKMFDAYVNTFSSTFNVPMEKLKTLVATAEAELAKNVSLDNVLSTFISAARQGFVDSDVETKDVVECL
KLSHQSDIEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVT
TKIALKGGLEPGCFAKGTNVLMADGSIECIENIEVGNKVMGKDGRPREVIKLPRGRETMYSVVQKSQHRAHKSDSSREVPELLKFTCNATHELVVRTPRS
VRRLSRTIKGVEYFEVITFEMGQKKAPDGRIVELVKEVSKSYPISEGPERANELVESYRKASNKAYFEWTIEARDLSLLGSHVRKATYQTYAPILYENDH
FFDYMQKSKFHLTIEGPKVLAYLLGLWIGDGLSDRATFSVDSRDTSLMERVTEYAEKLNLCAEYKDRKEPQVAKTVNLYSKVVRGNGIRNNLNTENPLWD
AIVGLGFLKDGVKNIPSFLSTDNIGTRETFLAGLIDSDGYVTDEHGIKATIKTIHTSVRDGLVSLARSLGLVVSVNAEPAKVDMNVTKHKISYAIYMSGG
DVLLNVLSKCAGSKKFRPAPAAAFARECRGFYFELQELKEDDYYGITLSDDSDHQFLLGSQVVVHACGGLTGLNSGLTTNPGVSAWQVNTAYTAGQLVTY
NGKTYKCLQPHTSLAGWEPSNVPALWQLQ*
Vector Type
Bacterial
Antibiotic
Amp
100042 R 1000 1001 1047 19007